SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3ZXL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3ZXL0
Domain Number 1 Region: 548-668
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.55e-16
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3ZXL0
Sequence length 684
Comment (tr|D3ZXL0|D3ZXL0_RAT) Solute carrier family 26, member 10 {ECO:0000313|Ensembl:ENSRNOP00000049501} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Slc26a10 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MLQGAKDKMSGPLASGTCSDLEEASDLKAPLSSRFREPLTHARFQELFGGAEQEPELPAE
PCLPWLCRLRRRRASACSGPGAWRVLLARLPPLRWLPQYRWRAWLLGDAVAGITVGVVHV
PQGMAFALLTSVPPVFGLYTSFFPVLIYSLLGTGRHLSTGTFAVLSLMTGSVVERVVPEP
LAGNLSGIEREKLEAQRIGAAAAVAFGSGALMLGMFVLQLGVLSTFLSEPVVKALTSGAA
LHVLVSQLPSLLGLSLPRQIGCFSLFKTLAAVLSALNQSSPAELTISALSLALLVPVKEL
NVRFRDRLPTPIPGEVVMVLLATVLCFTSSLDSRYNVQVVGLLPGGFPQPLLPTLDDLPR
ILADSLPISLVTFAVSTSLASIYADKYSYTIDPNQELLAHGVSNLISSLFSCFPNSATLA
TTSLLVDAGGNTQLSGLFSCTVVLSVLLWLGPFFYYLPKAVLACINISSMRQMFFQMQEL
PQLWHVSRVDFAVWMVTWVAVVTLNVDLGLAVGVVVSMVTVVCRTQRVKCLALGLAEGTE
LYRPIRESHKLLQVPGLCILSYPAPLYFATRGQFHRVLEWHLGLGERTKPGAEPIRVVIL
DFSGVTFADAAGAREVVQLTRRCQDDGICLLLAQCNDLVLKTLTRAGLLDSMTPEQLFVS
VQDAAAHALERLKPTGPKICTVWV
Download sequence
Identical sequences D3ZXL0
ENSRNOP00000049501 NP_001128067.2.100692 NP_001128067.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]