SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3ZYK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3ZYK3
Domain Number 1 Region: 182-413
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.5e-58
Family Voltage-gated potassium channels 0.0008
Further Details:      
 
Domain Number 2 Region: 39-144
Classification Level Classification E-value
Superfamily POZ domain 1.01e-32
Family Tetramerization domain of potassium channels 0.00000545
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3ZYK3
Sequence length 650
Comment (tr|D3ZYK3|D3ZYK3_RAT) Potassium voltage-gated channel, Shal-related family, member 1 {ECO:0000313|EMBL:EDL83824.1} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_22902 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MAAGVATWLPFARAAAVGWLPLAQQPLPPAPEVKASRGDEVLVVNVSGRRFETWKNTLDR
YPDTLLGSSEKEFFYDAESGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAF
YGLVPELVGDCCLEEYRDRKKENAERLAEDEEAEQAGEGPALPAGSSLRQRLWRAFENPH
TSTAALVFYYVTGFFIAVSVIANVVETIPCRGPARWPTKEQPCGDRFPTAFFCMDTACVL
IFTGEYLLRLFAAPSRCRFLRSVMSLIDVVAILPYYIGLFVPKNDDVSGAFVTLRVFRVF
RIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTSKTNFTSIP
AAFWYTIVTMTTLGYGDMVPSTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQR
ADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEGQMLCVRSRSAFEQQHHH
LLHCLEKTTCHEFTDELTFSEALGAVSLGGRTSRSTSVSSQPMGPGSLFSSCCSRRGERR
AIRLANSTASVSRGSMQELDTLAGLRRSPAPQSRSSLNAKPHDSLDLNCESRDFVAAIIS
IPTPPANTPDESQPSSPGGGGSGGMANTTLRNSSLATPCLLPETVKISSL
Download sequence
Identical sequences D3ZYK3
ENSRNOP00000011994 NP_001099218.1.100692 NP_001099218.1.4139 ENSRNOP00000011994 10116.ENSRNOP00000011994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]