SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3ZZC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3ZZC5
Domain Number 1 Region: 8-165
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 2.09e-67
Family TRADD, N-terminal domain 0.000000343
Further Details:      
 
Domain Number 2 Region: 218-305
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000226
Family DEATH domain, DD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3ZZC5
Sequence length 310
Comment (tr|D3ZZC5|D3ZZC5_RAT) TNFRSF1A-associated via death domain {ECO:0000313|EMBL:EDL92353.1, ECO:0000313|Ensembl:ENSRNOP00000020405} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_51460 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MAADQNGHEEWVGSAYLFLESSMDKVVLSEAYTDPKKKVAIYKALQAALSESGDSPDVLQ
ILKIHCSDPQLIVQLRFCGRLLCGRFLQAYREGALRTALQRCMAAALAQEAVRLQLELRA
GAEQLDSWLTDEERCLNYILAQKPDRLRDEELAELEDEFCKLTCDSTGQGGATQVAPAGS
KSLVSSPAEEKPLPAAGQTFLFHGQLIVNRPLNLQDQQTFARSVGLKWRRVGRSLQRSCR
ALRDPALDSLAYEYERDGLYEQAFQLLRRFIQAEGRRATLQRLVEALEENELTSLAEDLL
GQAEPEGGQA
Download sequence
Identical sequences D3ZZC5
NP_001093950.1.100692 NP_001093950.1.4139 XP_006255506.1.100692 ENSRNOP00000020405 10116.ENSRNOP00000020405 ENSRNOP00000020405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]