SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D4A404 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D4A404
Domain Number 1 Region: 44-210
Classification Level Classification E-value
Superfamily Sec7 domain 6.15e-59
Family Sec7 domain 0.0000409
Further Details:      
 
Domain Number 2 Region: 256-391
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-29
Family Pleckstrin-homology domain (PH domain) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D4A404
Sequence length 518
Comment (tr|D4A404|D4A404_RAT) Pleckstrin and Sec7 domain-containing 3 {ECO:0000313|Ensembl:ENSRNOP00000042590} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Psd3 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MGLILCRLHCCCYGYCFDKGKPTRLDGNSEMGSTEILEKETTENLSNGTNSNVEAAKRLA
KRLYHLDRFKRSDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFLKAFSLVGET
QERERILIHFSNRYFSCNPDTITSKDGVHCLTCALMLLNTDLHGHNIGKKMTCQEFITNL
QGVNEGGDFSKDLLKALYNSIKNEKLEWAADDEEKKKSPSEGTDEKANGTHPKTISRIGS
TTNPFLDIPHDPNAAVYKSGFLARKIHADMDGKKTPRGKRGWKTFYAVLKGTVLYLQKDE
YKPEKSLSDEDLKNAVSVHHALASKATEYEKKPNVFKLKTADWRVLLFQTQSPEEMQGWI
NKINCVAAVFSAPPFPAAIGSQKKFSRPLLPATTTKLSQEEQLKSHESKLKQITTELAEH
RSYPPDKKVKAKDVDEYKLKDHYLDFEKTRYEIYVSILKEGGKDLLSTEGNEPVGLKKSH
SSPSLNPDASPVTAKVKRNVSERKDHRPETPGIKQKVT
Download sequence
Identical sequences D4A404
ENSRNOP00000042590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]