SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D4A754 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D4A754
Domain Number 1 Region: 49-485
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.81e-103
Family L-arabinose binding protein-like 0.0039
Further Details:      
 
Weak hits

Sequence:  D4A754
Domain Number - Region: 567-684
Classification Level Classification E-value
Superfamily Clc chloride channel 0.00471
Family Clc chloride channel 0.021
Further Details:      
 
Domain Number - Region: 508-557
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00918
Family TNF receptor-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D4A754
Sequence length 850
Comment (tr|D4A754|D4A754_RAT) Vomeronasal 2 receptor, 68 {ECO:0000313|Ensembl:ENSRNOP00000042077} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Vom2r68 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MKELCTFTISFLLLKFSFIMWGLTEPSCFWRIKNNGDNDGDLRTDCGFVLFTRQEPIEEN
FYNEIVYFRIPARSYEFFLVMFFATDEINKNPYLLPNMSLIFSLIVGMCEDTLEYVDTNY
SFKRNTLNIVNYNCYLRARCYIQLTGPSWKTSLKLTINSRKPKVFFGPFNPNLSDRDQFP
YVNQIARKDTFLSHAMISLMLFFEWTWIGLAISDDDQGIQFLSVTREVMQKHSICSAFVN
VIPENMQIYMARANIYDKQIMTSSAKVVIIYGERNSTLEVSFRRWEYLGAQKIWITTSQW
DVITNKRVFSLDFFHGTVTFAYHNGRIPKFRNFMQTMNTSKYPVDISQTILEWNYFNCSI
FKNSDSEMNHFTSKNTEEWLAQHKFDMVLSEEGYNLYNAVYAVAHTYHELILQEVESQKI
LRHKGRFINCQQVASLLKTRIFMNPVGELVNMNQRENQCAEYDIFNIWNFPQGLGLKVKI
GSYFSCFPQSQQLQISEDLKWATGGTSVPTSMCSVTCTAGFRKIHQNEAAHCCFDCALCP
ENEVSNDTADMEQCVRCPDDKYANLEQTYCIQRHVSFLAYEEPLGLTLGCMALCFSALTI
LVLVTFVKHKNIPVVKANNCILSYILLISLIFCFLCSLLFIGHPKKTTCILQQITFGIFF
TMAISTVLAKTITVVMAFKLTTPGRRMRRILASGAPNLIIPICTLIQLVICGTWLATSPP
FIDRDIQSEHGKVIIICNKGSVTAFHFVLGYLRSLALGSFAVAFLARNLPDRFNETKFLT
FSMLVFCSVWITFLPVYHSTRGKVMVVVEVFSILASSAGLLGCVFIPKCYVILVRPNSNF
LQKYKNKLLY
Download sequence
Identical sequences D4A754
ENSRNOP00000042077 ENSRNOP00000042077 NP_001092951.1.100692 NP_001092951.1.4139 10116.ENSRNOP00000042077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]