SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D4ABM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D4ABM4
Domain Number 1 Region: 91-272
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-56
Family SPRY domain 0.0000012
Further Details:      
 
Domain Number 2 Region: 5-75
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000012
Family RING finger domain, C3HC4 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D4ABM4
Sequence length 285
Comment (sp|D4ABM4|RFPLA_RAT) Ret finger protein-like 4A KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Rfpl4a; OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MAHFFKENSSCYFCFRYLENPVYLNCGYICCFQCLDSLEKSPEGDGVLCPNCSVVSLKED
IRHAKQLRNLVTTVKDLEPQLNFILTMDPSMKIFQVNMILDVDTAQNNLIISEDLRSVYH
TSQTQDRKKCAERFDPSPCVLGSSRFTSGCHYWEVVVGTSKEWDIGICKESINRQEVVYL
SEKKGFWTVGVRNEEVYAASTDPLTVLLVNPRLHRVGIFLDLLEKSVSFWDLGDGSHIYT
FLEIPDTEPFRPFFSPANTYPDEEQVISICPVMNPSIFGLPVNPV
Download sequence
Identical sequences D4ABM4
ENSRNOP00000021077 10116.ENSRNOP00000021077 ENSRNOP00000021077 NP_001099692.1.100692 NP_001099692.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]