SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D4ADP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D4ADP7
Domain Number 1 Region: 323-404
Classification Level Classification E-value
Superfamily DEATH domain 8.75e-20
Family DEATH domain, DD 0.00082
Further Details:      
 
Domain Number 2 Region: 37-90
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000273
Family TNF receptor-like 0.0022
Further Details:      
 
Weak hits

Sequence:  D4ADP7
Domain Number - Region: 99-150
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00153
Family TNF receptor-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D4ADP7
Sequence length 407
Comment (tr|D4ADP7|D4ADP7_RAT) TNF receptor superfamily member 25 {ECO:0000313|Ensembl:ENSRNOP00000052331} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_31294 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MEQRPRGCVVEPLFLPSLLLLLLLLLGGHGQGGTPGRCDCASEPQKRYGQLCCRGCPKGQ
YMKAPCTEPCGDSSCLPCPPGTFLARDSHFKTDCTRCQVCDEEALQVTLENCSAETDTHC
GCQSGWCVDCSTEPCGKSSPFSCTPCSSYEPTTYRPCPPGFYIHGNGCASCPTSFSSVCP
KACTAVCGWKQMFWVQVLLGASFLLGTVLICAYCRWQPCKPVVTADIAGMETLASPQTTH
FSASDSAHTLLPPPGSTGKVCTTVQLVGNNWTPGLSQTEEVVCRQASQPWDQLPNRTLGP
PLVPPLSPAPPAGSPAAVLQPGPQLYDVMDAVPARRWKEFVRTLGLREAEIEAVEVEICR
FRDQQYEMLKRWRQQQPAGLGAIYAALERMGLEGCAEDLRSRLQRGP
Download sequence
Identical sequences D4ADP7
ENSRNOP00000062604 NP_001131116.1.100692 NP_001131116.1.4139 10116.ENSRNOP00000052331 ENSRNOP00000052331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]