SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D4KM50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D4KM50
Domain Number 1 Region: 19-59,206-429
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.53e-36
Family FolH catalytic domain-like 0.04
Further Details:      
 
Domain Number 2 Region: 97-205
Classification Level Classification E-value
Superfamily PA domain 0.000000000157
Family PA domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D4KM50
Sequence length 671
Comment (tr|D4KM50|D4KM50_9FIRM) Predicted aminopeptidase, Iap family {ECO:0000313|EMBL:CBL07952.1} KW=Complete proteome OX=657315 OS=Roseburia intestinalis M50/1. GN=ROI_07050 OC=Roseburia.
Sequence
MQEAVIKNIDTDYSYQLAKRMEQFHSNEKLGYRPAGSKAEFLTGEMLKDEMQKLGLSDVC
KNAVTVDGWEFENAELTFETKEGKRHTALLGAYQTDFVTDGEQAFSLMYLGKGTEADYEG
KDVTGKLVLVDINQRDEWWINYPVYQAHLKGAAAVIAVQCGGYGEVDAKALNAQDIAGPE
DAPAFSISREDAALLRELLDGEKEATVWLKADSRVKRDCTTYNISGCIPGKHPERMVLLS
AHYDSYFSGFQDDNTAVAMMFGIAKTLIESGFKPNNTIVFCAMAAEEWGVVDSNFDWSTG
AYEQIFTAHPEWVGKVIADLNFELPALAHGTRARIRCCYEYVHYIKEYLDGLPELTKAYP
EMTSVTAPIETWSDDFSMAIAGIPSMVNDFTGGSFMETHYHSQFDNDDFYDEAVYRLHHE
LFTLLILALDETAVVPLDFTPVLERILAGGSEITAKVEETQEQIAAITKKLIQVTEEAQE
KAKQSYEETAAINTRYYALLAEGNMQEAEQLFAENREREKQLLVKFKQEQDHFVRIDWYG
EVFFPHEILWKNIGLLQDSVNALEQSDVDKALEKIYQVDNNAYAFMFDEYVYRHFTDYVF
NQPKDRLKWGYGRLLGHEDLYHVVKCLLKKRKEADTDYREELHYLKECYKKQTRRLCETL
KEISQTVKEMF
Download sequence
Identical sequences D4KM50
gi|479202402|ref|YP_007830993.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]