SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D4L525 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D4L525
Domain Number 1 Region: 100-176,245-280,344-447
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000000136
Family Internalin LRR domain 0.08
Further Details:      
 
Domain Number 2 Region: 475-547
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000412
Family Type I dockerin domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D4L525
Sequence length 549
Comment (tr|D4L525|D4L525_9FIRM) Dockerin type I repeat {ECO:0000313|EMBL:CBL14720.1} OX=657321 OS=Ruminococcus bromii L2-63. GN=RBR_02970 OC=Ruminococcus.
Sequence
MRKRVNKIISVALSATLAFGVFTALPMSANAAVSTASEVSAEAIPKHELYKSYTYGGYKY
RIVGQKSNGRFNAWIESYSGKSASVNVPASVGDCDMVGIDNNCFSFNKTLKTIIVPKGIA
EIGSSAFLGCTALTSVSLPSTLTKINFWAFKNCTSLSTLSIPSSVVSIGDNAFDNCLWYT
NQSNGIVYAGKVAYKYKGKLADNSSVTIKSGTVSIADYAFTDQKLTSVTLPSSLVSIGEQ
AFSYTNLKTVTIPKSVSSMGYNPFAYCSQLSSITVQSGNTNFYVQNDLLIAKNHMYSVTK
DITDPDAPSTESRSYTSYAPYGSVVISFPSASTLKTVTIPETVKAIGNYAFAGSKIEKLT
LNSGLESILTSAFSGCTNLSSVSFSDSIISICDSSFEECTSLKNLKFGKNLEFISYYAFY
NCQNLQSVTIGENVKAICCDSFGNCNALVINGKIGSTAETFAKKYGYKFNSSETTRLKGD
VDNNGIINVVDATDIQKYIVNLTDENGNKFIDVNNAEDVYVADVNGDGIINVVDATLIQK
YIVGLVESL
Download sequence
Identical sequences D4L525
gi|479150321|ref|YP_007780497.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]