SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D4L8T7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D4L8T7
Domain Number 1 Region: 187-542
Classification Level Classification E-value
Superfamily Subtilisin-like 3.27e-59
Family Subtilases 0.0000293
Further Details:      
 
Domain Number 2 Region: 636-692
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000876
Family Type I dockerin domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D4L8T7
Sequence length 698
Comment (tr|D4L8T7|D4L8T7_9FIRM) Subtilisin-like serine proteases {ECO:0000313|EMBL:CBL16032.1} OX=657321 OS=Ruminococcus bromii L2-63. GN=RBR_18680 OC=Ruminococcus.
Sequence
MRKSIKIISSIFLSSMFMINGTLFAFATTDDINENLESKELCEASINEAFAADSIIVTMK
NSCSLDFKNYDCADFPEVAVNSVENLSPYTYDVIKDKYEAIIARGVSATGGIQALKNYIE
NIDDSKSASSKFISYIKNMNLIKILGTRKNGLALFDASSQKRELVYSIDNFINKLDDEYD
FLENYDYTDYHLTLKLSLDTNDKKSVLKAIDKIEQRDDVLSVSPNYQFEYDSVTKPNDEY
LSNQWYLNRIGYFDALQYTKNTKTVRVGVMDSGVNADNPDLKDTVNRELSKSFVDDEPLT
DSADHGTCVAGIIGACSNNSVGISGICNSVEIVSLKVGKEGGPLFSNISLALDYAEKNKI
DLVNCSFGTLAFKDGNTKEPEECYGKYTGLIINSSGNESLDLDNQGFYCFPTSLKYDNII
SVANSNENDKLNNSSNYGKISVDLAAPGTNIYTTSSNDYRNFNGTSASCPMVTGSVALMK
SIYPDISNSQLKAFLLNNVDSVDGLKDKLVSGGVLNIGKTLAAINSKKYIIKYDANGGNG
VAMVNTSVCYGVNTKLNPNTYTKLDYRFVGWTAYRKSDNKWYYTDGKGNSKWCLENKQPN
GYSKAVYKDCSKVAKTSSVNGDVVTMYAQWEKLQLGDVDMDGEVTIMDATLVQKYIAHLE
DLTDQQKRLADVNGDGEITILDSTEIQKMLVNVKNKEA
Download sequence
Identical sequences D4L8T7
gi|479151633|ref|YP_007781809.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]