SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D4M4D3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D4M4D3
Domain Number 1 Region: 245-338,550-665
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000466
Family ABC transporter ATPase domain-like 0.023
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily PHP domain-like 0.00000011
Family PHP domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D4M4D3
Sequence length 712
Comment (tr|D4M4D3|D4M4D3_9FIRM) PHP domain {ECO:0000313|EMBL:CBL26095.1} KW=Complete proteome; Reference proteome OX=657313 OS=Ruminococcus torques L2-14. GN=RTO_14890 OC=Blautia.
Sequence
MRIDLHCHTKKVKTGDAYTRNVTKDKFFQKVIEAEVKIIAITNHNQFDYLQYKEFKDVTE
GYCDIWPGVELDIIGKADQKGNCKRGHLIVIANPKNVELFNTQVQELVNDEDVNTFQIGV
KKVYETLGKCDCIYIPHFHKEPKLSDEDIQELGELLPDSSRLFKETSDYRSLGVFSNFDY
SVIIGSDVQDWDKYEISKFADIRLPVQTFEQFCLLAKKDVQIIDTLLNQKRKKEIPVSPY
KKVNFKLPFYEDINIIFGQKGTGKTEILESLKKYYIENGIAMESYKGNEKDSDFSKMLKV
NDIIATPDKLQLDSMRQQFIDIYNWKEELPTSFEKYISWMETKDNNKNKGRMKITECVHI
EEGVRDRKLESDYKYLKEFTESTFEKIDIEKYLDERERTILMLLLEKLCKNINDAKMQKW
NSDKSIKLTNWSIDKIKAIADKCSDTISKPSSVGFYDFAMGRFKLFENVEEICSTFSVED
KVEKEYLGNLEEKGDIYIQTRYRMLTKESRTDEFKQGITVLRNCKLVIDGIKKAALAENI
SEEVSKFQEFYDDGIKDIGTFIGVSKETALENGEIYRPSNGERGILLMQKLLDSERDAYI
LDEPELGMGNSYITSNILPKLTDLAKRRKTVIIATHNANIAVGTLPYISILRTHENGVYK
TYVGNPFYDELRNIDDETDTKNWTQESMHTLEGGKTAFYDRKDIYESGKQSD
Download sequence
Identical sequences D4M4D3
gi|479157008|ref|YP_007786603.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]