SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D4P8S0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D4P8S0
Domain Number 1 Region: 352-486
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.28e-41
Family Synaptotagmin-like (S variant) 0.0000548
Further Details:      
 
Domain Number 2 Region: 218-348
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.71e-40
Family Synaptotagmin-like (S variant) 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D4P8S0
Sequence length 488
Comment (tr|D4P8S0|D4P8S0_DANRE) Synaptotagmin VIIb {ECO:0000313|Ensembl:ENSDARP00000136207} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=syt7 OC=Cyprinidae; Danio.
Sequence
MHLNREDEDGKGSLSLSVFLVSVGLTVCVVWLVALCGVCGWCQRKLGMRNKPGVETAGTP
DSVSVSGRGRGENKAINHNDLDRDFWNNNDSCSVQQRWSSYPPKEFLLNMSPYAPYGDPR
LTPKEGKMVVLSLAIGLAEQDDFANLPDLQEAPADTETPPTDKRSNKPGSSPKGQTPDES
HRRTDANSSVSDLANSVTSDMLMLSPGSEEEEHEGPVCEKLGRIQFSVGYSFQDSTLTVK
ILKGQDLPAKDFSGTSDPFVKLYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVV
QRTLYLQVLDYDRFSRNDPIGEVSIPLNKVELVPMQTLWKELKPCSDGSGSRGDLLVSLC
YNPTANIITVSIIKARNLKAMDIGGTSDPYVKVWLMNKDKRVEKKKTVVMKRCLNPVFNE
SFPFDVPAHVLRETTIVITVMDKDRLSRNDVIGKIYLSWKSGPAEVKHWKDMMSHPRTAV
AQWHALKA
Download sequence
Identical sequences D4P8S0
ENSDARP00000092005 NP_001232886.1.45394 ENSDARP00000092005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]