SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D4ZHN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D4ZHN4
Domain Number - Region: 136-184
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0049
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D4ZHN4
Sequence length 221
Comment (tr|D4ZHN4|D4ZHN4_SHEVD) Protein Syd {ECO:0000256|HAMAP-Rule:MF_01104, ECO:0000256|SAAS:SAAS00851392} KW=Complete proteome; Reference proteome OX=637905 OS=DSS12). GN=SVI_1212 OC=Shewanellaceae; Shewanella.
Sequence
MSSLPALDNLFKIYQLAYFEKLGELPRYYPRGEGSTCIEGEYEPSNYHESDEEVSVCWKP
VTRPEPGSFSNIETALELEFGPDIDAFFGEYFSAPLLFNCEWGQGELLQVWNQTDFEYLQ
QNIIGHLMMKKKLKQAPTWFIGVLGDGDNMLTVDISDGSVWIEIPGEAPSEKLADSLNEF
ISQLTPRVAPPELHIEESMPELDHPGIWNRIKLMWRNLRGK
Download sequence
Identical sequences D4ZHN4
gi|294139983|ref|YP_003555961.1| WP_013050494.1.44054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]