SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D4ZRE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D4ZRE1
Domain Number 1 Region: 9-210
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000000547
Family Atu1826-like 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D4ZRE1
Sequence length 258
Comment (tr|D4ZRE1|D4ZRE1_ARTPN) Uncharacterized protein {ECO:0000313|EMBL:BAI94364.1} KW=Complete proteome; Reference proteome OX=696747 OS=platensis). GN=NIES39_R00550 OC=Microcoleaceae; Arthrospira.
Sequence
MDWLEFSDNWVLIPPKPKAIVHFLGGAFVASAPHITYRWLLEQLALQGYAIIATPFINTL
DHGNMAREVLWTFEDGLEDLFAAQKLRRRGLPIYGIGHSMGCKLHLLIGSLFEVERAGNI
LLSFNNYAARQSIPLVEQLSSVIDVEFTPTPQQTNSLVGDRYQVRRNLLIQFSNDKIDQS
TGLYQILNGRFPGLVTLQQLRGDHQTPLAQDLSWPRGESFSPLDAIGQWLKHEVYKDLYQ
LRREVLQWLNPLSPVKNI
Download sequence
Identical sequences D4ZRE1
WP_006616796.1.32502 WP_006616796.1.3704 WP_006616796.1.77122 gi|479132942|ref|YP_005072902.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]