SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D5AWV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5AWV9
Domain Number 1 Region: 200-360
Classification Level Classification E-value
Superfamily RalF, C-terminal domain 2.75e-73
Family RalF, C-terminal domain 0.0000256
Further Details:      
 
Domain Number 2 Region: 11-196
Classification Level Classification E-value
Superfamily Sec7 domain 3.66e-55
Family Sec7 domain 0.00000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5AWV9
Sequence length 462
Comment (tr|D5AWV9|D5AWV9_RICPP) Sec7 domain containing protein {ECO:0000313|EMBL:ADE29898.1} KW=Complete proteome OX=449216 OS=Rickettsia prowazekii (strain Rp22). GN=rpr22_CDS366 OC=Rickettsiaceae; Rickettsieae; Rickettsia; typhus group.
Sequence
MGDKMDSLLKNEVIKLFNDKPKSGIARIKKWCTDNNQDFIAETAKIFYEEKSNLNLEFVG
DYLGTDGVDNQKVLESFTKQFDFKEKDYLESLRRFLQSFKLPGEAQKIDRLVESFGTHYY
EQNLNIDINSKDAAYILAYQTIMLNTDLHNPSIAKSKKMTFEQLKNNLKGTNESKNFNDN
FLKKIYDEIEAKPFKLNFVDSSPGYQINNISSQNDKTFKQLNQFLEEKRNIQNIFPKLQN
NNLTIEFKNPKTFLSKFTGYKGSVIIKDEKSGAAEIQVYKPSIFSRWFLGEKSKIIIQPL
REEGRQPSEQSLKLAAQITASFETKVTSIKATYDYLKEDLKSQYDNIRNPKKELEKASAI
AEGHKNIKYITEIVHQINQPVKNAVAVFSSTISVEPQISKSDLPIKPPQLPVPKSIPNVV
KKAAKDISKQIPHERDKHKEELAKALEIQRRKIEKQNSGRVV
Download sequence
Identical sequences D5AWV9 Q9ZDF5
gi|386082219|ref|YP_005998796.1| NP_220757.1.81248 WP_010886278.1.19079 WP_010886278.1.38548 WP_010886278.1.39958 WP_010886278.1.6643 WP_010886278.1.75108 WP_010886278.1.82014 WP_010886278.1.8209 WP_010886278.1.9355 WP_010886278.1.96644 gi|15604241|ref|NP_220757.1| 272947.RP374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]