SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D5EGF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EGF1
Domain Number 1 Region: 167-253
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.07e-35
Family CodY HTH domain 0.00012
Further Details:      
 
Domain Number 2 Region: 30-174
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000638
Family GAF domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5EGF1
Sequence length 261
Comment (tr|D5EGF1|D5EGF1_AMICL) GTP-sensing transcriptional pleiotropic repressor CodY {ECO:0000256|HAMAP-Rule:MF_00621} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_1516 OC=Aminobacterium.
Sequence
MKDLLDKTRQVGRALQSRREGTKPDYSKLAKLLCEFSTANVYIINREGRILVHSWVSEYH
SEAVANFLERGYMPESFVEKMNQHRESILSETDGYLFDDEVASKEAPEKHLLYVPIYSAA
ERLGTLLLVRFFNPFYMKDLILAEYLATLVGIEILHDRTRSIEERARERLVVQMAMRALS
YSEVESVKHIIAELGTYEGVVIASKVADRVGVTRSVIVNALRKLESAGIIESRSLGMKGT
FIKILSPLFIEELGMVLTQNN
Download sequence
Identical sequences D5EGF1
gi|294102499|ref|YP_003554357.1| WP_013048896.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]