SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D5ERP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5ERP8
Domain Number 1 Region: 670-775
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000711
Family Glutathione peroxidase-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5ERP8
Sequence length 796
Comment (tr|D5ERP8|D5ERP8_PRER2) Uncharacterized protein {ECO:0000313|EMBL:ADE82015.1} KW=Complete proteome; Reference proteome OX=264731 OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23). GN=PRU_0965 OC=Prevotella.
Sequence
MKKLLSTIVLAIVATAGWAQTRIWNNIVTGYSNVPFVKITKVVLSADSTEVFMHFDMPER
AAGQEGVLAAKSLLQADGKTYEAKNAVGMKLGQPVKIPKDCKVDFSLVFDALPASTWLFS
ISDPGIWIINAVRDADANADVDVTPVGITDTYWRNTLTGDWLIGFAQHHVIYNNKVWDIL
NQTEQKDTYVLTLNDGLTIKVGKLKKGIRPITIGTGKAIACNPITQEALPDYPTKDTRKG
FVDNGYREGDSVTIVGWLKDMPEQAWKQSGEFEVWTSNFITDKTESFTAKLDSLGRFTLR
MPLLNSATVTLAPRQSWVHPVLEPGKTYFFLNDFNTGQKLFMGDDVRLQNELVACPATWP
ETRINPGESAMQFMERANKVFDAIITKMQADITHRPNLSQRFIDYIKGLCMAGQGYSMMQ
ARFDVPGRSLPKEYMDYVNTKLWQPAPKPYTLYSEFPRFMRDYLDQLRDERHSVSIDPYR
ITLNDGAYPIILRQARADGKVSITDEELALMERYAVEFHKEYAKQAKNQKIDSLNIDLAG
TDLDKLGIAEQYLAIMERPDVKKEIEQEFSLIDLYYQKQAIESATTDRALIDLALARKFY
WKLNSFRKSLDPSDLNFANKEIKLASALNFVLTENDKYVALEHQDLANAASLRPSTDVAN
MTDGEKMLRKIIEPYKGRVIYLDVWGTWCGPCKQKLKDSWKVKEALKDYDIVYLYLCNGS
SDESWKNVIKEYNLTGPNCVHYNLPKEQQSAIEHYLSVNSFPTYKIIDKQGNIHDLGWLD
DQNLEAFKQTMGKFCK
Download sequence
Identical sequences A0A1H6MVG5 D5ERP8
WP_013064002.1.33358 WP_013064002.1.49956 gi|294673686|ref|YP_003574302.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]