SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D5EUY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EUY4
Domain Number 1 Region: 655-778
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.75e-16
Family Thioltransferase 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5EUY4
Sequence length 781
Comment (tr|D5EUY4|D5EUY4_PRER2) Uncharacterized protein {ECO:0000313|EMBL:ADE83405.1} KW=Complete proteome; Reference proteome OX=264731 OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23). GN=PRU_2156 OC=Prevotella.
Sequence
MKKLLSTIVLAITCVAALAQKSKVWDDVITGYCNIPVIDITKVTFTPDSTEVCMRLSFRA
GKQFGFTSGTHLKVGTQQYAVKNATVIKLNEGYTMPTDTVDFSLIFNPAPLGTTRMDLIE
PAGLTFSNIHGAGEIPDGIIDTYWRNNATGDWLIGFAVNHVIYNNKVWDIATLTNNKDAY
TIALTDGPIIKVGKLKKSKRTIGIDQQKGIVCSPITTATMPDYPTKDMRKGFVDNGYRAG
DSVTIVGWLKDMPEQAWKQSGEFEAIISHLIIDNQERYTTKLDSLGRFTLRFPLVNSSDA
FLDLRRSSVSPVLEPGKTYFFLKDFKTGQVLFMGDDARLQNELAACPAAWGYRRINQGED
AMQFKTRMDGICEAMKAEIQENIAKRPNLSQRYIDYVNGLCLAGQGESMMQARFVVPGKE
LPKEYMDYVTTQLWQKMPKPYTLFMPFSTFMRDYLDQVVTERHGVKIDRYTITLPEGAYP
TILRRAKADGRVSITDDEIALVERYAEAYRKEYAAQAQNQKIDSLNINISNSYSEQYLAI
MERPDVKTVIDEESTLVDIYYQLEAVKSTNPDPALIDLALAHRFYWTLNSFRKSLAPAAL
NFALQEIKLPAALDIVKTTNDKYIALEHQDLTNAASLRPSTDVENMTDGEKMLRKIIEPY
KGRVIYLDVWGTWCGPCKQRLKDSWKEKEALKDLDIVYLYLCNGSSDESWKNVIKEYNLA
GPNCVHYNLPKEQQSAIERYLNVQGFPTYKIIDKQGNIHDLDWLHADDMEAFKQTMEKFC
K
Download sequence
Identical sequences A0A1H6JA51 D5EUY4
gi|294674806|ref|YP_003575422.1| WP_013065388.1.33358 WP_013065388.1.49956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]