SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D5EVU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EVU2
Domain Number 1 Region: 257-386
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.04e-20
Family Glutathione peroxidase-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5EVU2
Sequence length 403
Comment (tr|D5EVU2|D5EVU2_PRER2) Thioredoxin domain protein {ECO:0000313|EMBL:ADE82529.1} KW=Complete proteome; Reference proteome OX=264731 OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23). GN=PRU_2342 OC=Prevotella.
Sequence
MKIDSAIASEPQKMYMYSMIEREMQLHDSISFDSLHREGTMHGYVPYEYNVNLMLQRRGP
QCVPIVVKGGDSLTIHIGDEDDGFRLRYIDKVQGSPSTLEMVHYQCRYDSLRQVYLNQNN
MSQLYNLSDAQCDSIRAIAKQEKDKLERYILDYACTGKSPYSVIEAASDVFYSFRRNPTL
YPYTEKEVDDMMNSLLVRFPDYSPMKAFVNDSTMGTYMSAQSFEIWAGMQLRTYSERFQK
EDKVKVRPLKVGDYMNLRLYNGAKPNVNEFRGKYVLVDFWASWCQPCMAQMPNIRYAAQE
FSDDLAVCLIGIDENRKQWWSTVKEKDLRNKDATQTDRPYKIYNYYAYDDKKRVMYPEYQ
ALDIQTIPHNYLVDRSGRIIAKNISITLAIDKLKILLEKEKQQ
Download sequence
Identical sequences D5EVU2
gi|294674981|ref|YP_003575597.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]