SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D5EXD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EXD7
Domain Number 1 Region: 256-384
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000456
Family Glutathione peroxidase-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5EXD7
Sequence length 384
Comment (tr|D5EXD7|D5EXD7_PRER2) Putative lipoprotein {ECO:0000313|EMBL:ADE83282.1} KW=Complete proteome; Reference proteome OX=264731 OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23). GN=PRU_2632 OC=Prevotella.
Sequence
MKHICKAAAVVLAALSIASCNNNKFTVEGQIAGAKDSVLYFENVGLEGINVLDSVKLNDN
GDFSFSQDATTAPEFYRLRIADQIINVSIDSTETVQVKGQYPGMASNYTISGSENCEKIR
ELALKQIDLQAKAIALQSNTELGIAKANDSIQSMINAYKEEVKRNYIYKEPYKAYAYFAL
FQAIGNYLIFNPRANKEDIKAFAAVATSWDTYYPHAERGQNLHNIAIEGMKNQRIVEAQN
ADIQIEASKVQEAGVLDIALLDNKGNMRHLTDLKGQVVLLDFHVFALKDSPARIIQLREL
YNKYHAQGLEIYQVSLDSDEHFWKQQTAALPWISVRDEDGAGSQRLTLYNIQAVPDFFVI
DRGNNLVKRAAQIADLEAEIKKLL
Download sequence
Identical sequences A0A1H6LJL0 D5EXD7
gi|294675264|ref|YP_003575880.1| WP_013065265.1.33358 WP_013065265.1.49956 WP_013065265.1.69841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]