SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D5EY11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EY11
Domain Number 1 Region: 228-350
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.71e-31
Family Glutathione peroxidase-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5EY11
Sequence length 362
Comment (tr|D5EY11|D5EY11_PRER2) Thioredoxin domain protein {ECO:0000313|EMBL:ADE83729.1} KW=Complete proteome; Reference proteome OX=264731 OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23). GN=PRU_2725 OC=Prevotella.
Sequence
MKKVFVMMAVLLASVTASANDNFKLTGKIDGASNDTLCIEYTILQPQKQHMVHKVAVKAG
EFLFHANLKEAYSAKMYLKTNPKESLYFYLVPDEEAVFSGSLNSVDEHWSGSTFYQQYER
ITELQRPFNIEFVAARNDPDSIRGEKNRDINRRAHSVYMKYIEEHPDEDATATLIVYVGY
EQVLPAMAKLTPEVRNGRMKSDLDSLERMFKQVLKEAAARKAVKNDTVTIGTQVPELGLK
DLQGNVLELKSLRGKYVVLDFWGSWCTWCIKGFPKLKEYYAKYKDRLEIVGIDCNDTAEK
WAAAVKKHNLPWLQVRSEDGITEDRFRIKGYPYKVLISPEGIVLNAYLGETADFYQYLDT
AL
Download sequence
Identical sequences A0A1H6LBX0 D5EY11
gi|294675355|ref|YP_003575971.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]