SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D5GL40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5GL40
Domain Number 1 Region: 164-359
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.51e-31
Family Hypothetical protein AT3g04780/F7O18 27 0.001
Further Details:      
 
Domain Number 2 Region: 4-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.18e-27
Family Thioltransferase 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5GL40
Sequence length 378
Comment (tr|D5GL40|D5GL40_TUBMM) Uncharacterized protein {ECO:0000313|EMBL:CAZ85233.1} KW=Complete proteome; Reference proteome OX=656061 OS=Tuber melanosporum (strain Mel28) (Perigord black truffle). GN=GSTUM_00009960001 OC=Pezizales; Tuberaceae; Tuber.
Sequence
MANVSIITSPEQFEELKKTSTLLIIDFHAIWCAPCKIVNPVFMKLAEKFASPGKIVFAKC
DVDDNQQISKDLDVTVMPSFLVFNNGALVERVQGARPMVLRTTLTKLVEGVQASDSGSSS
AAEGLTASETKPTATSSTSAATASTAAGTTSTPAVNTSDDSDAGWLGAELPKPYSDVTDQ
VNLKQLDLLNANSEFGPAKTLFDMKAPSKATASSKGKEKDSGTEVAASRDWVESDTDEQL
MLFIPFQSTVKIHTLQVTSLAPAPEHPDYDKDSDTPSRPKTIKIWVNPPHTLSFEDGESP
ATQEITLNPSDWDPKTGTVSVPLKYVKFQSVSTLNIFFVDVENEDAEKVRIDRLRVIGEK
GEKKEMGKLEKIGDLSGE
Download sequence
Identical sequences D5GL40
CAZ85233 GSTUMT00009960001 XP_002841042.1.11696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]