SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D5U257 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5U257
Domain Number 1 Region: 13-144
Classification Level Classification E-value
Superfamily Prefoldin 6.02e-16
Family Prefoldin 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5U257
Sequence length 159
Comment (tr|D5U257|D5U257_THEAM) Prefoldin, alpha subunit {ECO:0000313|EMBL:ADG91207.1} KW=Complete proteome; Reference proteome OX=633148 OS=Thermosphaera aggregans (strain DSM 11486 / M11TL). GN=Tagg_0935 OC=Desulfurococcaceae; Thermosphaera.
Sequence
MSDVQAEGGKTITLEELIARASELREYITVLSNTINSYVTQYRELQLASETLKNLPEAGG
EGFVVVDRLSSVLVPGIVKEGWTASVLVNIGFGYYLKTSRDKAVEVIEKRLASVNRLLDE
LQKRYKTALDEYSALQGILNQVYAEAQNTEEAGGQASGG
Download sequence
Identical sequences D5U257
gi|296242672|ref|YP_003650159.1| WP_013129800.1.1770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]