SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D5U391 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5U391
Domain Number 1 Region: 8-113
Classification Level Classification E-value
Superfamily Prefoldin 5.1e-20
Family Prefoldin 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5U391
Sequence length 123
Comment (tr|D5U391|D5U391_THEAM) GimC subunit beta {ECO:0000256|HAMAP-Rule:MF_00307} KW=Complete proteome; Reference proteome OX=633148 OS=Thermosphaera aggregans (strain DSM 11486 / M11TL). GN=Tagg_1330 OC=Desulfurococcaceae; Thermosphaera.
Sequence
MSRKTLPPEVQQLIVQYQTLKETHAKIDAELKLTEAELTDVDTVLNTVKNLEDTAELYKV
VGHILVKKGKNDVIKELEERKEVLSLKRDKYKKQLDFLVKQISELEAKLKEALGRYGITV
GQA
Download sequence
Identical sequences D5U391
gi|296243056|ref|YP_003650543.1| WP_013130184.1.1770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]