SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D6EMT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6EMT0
Domain Number 1 Region: 2-260
Classification Level Classification E-value
Superfamily Cgl1923-like 1.7e-88
Family Cgl1923-like 0.0000816
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D6EMT0
Sequence length 333
Comment (tr|D6EMT0|D6EMT0_STRLI) Uncharacterized protein {ECO:0000313|EMBL:AIJ16786.1} KW=Complete proteome OX=457428 OS=Streptomyces lividans TK24. GN=SLIV_29435 OC=Streptomyces.
Sequence
MIELEGVPELVDPVMVAAFEGWNDAGDAASTAVAHLDREWKGEVFAALDAEDYYDFQVNR
PTVFMEDGVRKITWPTTRLSVVRVGGDKPRDLVLVRGIEPSMRWRSFCNELLGFAHELGV
ELVVVLGALLGDTPHTRPVPISGTTSDADLARRMDLEETKYEGPTGIVGILQEACTHAGV
PAVSLWAAVPHYVSQPPNPKATLALLNRLEDLIGVRVPLGELPEDARAWQVGVDQLAAED
TEVAEYVQSLEEARDTAELPEASGEAIAREFERYLRRRDGAGPGGPGGPGGHATADGGDG
PAGAPFRRDNPSGRARPPKPPKAGGDDEESSED
Download sequence
Identical sequences A0A1H1X5M9 D6EMT0 Q9ADA5
gi|21220158|ref|NP_625937.1| 100226.SCO1662 NP_625937.1.49638 WP_003977163.1.26049 WP_003977163.1.30910 WP_003977163.1.43399 WP_003977163.1.55229 WP_003977163.1.58943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]