SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D6JFH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6JFH5
Domain Number 1 Region: 3-188
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.1e-21
Family 2,6-dihydropseudooxynicotine hydrolase-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D6JFH5
Sequence length 193
Comment (tr|D6JFH5|D6JFH5_ECOLX) Uncharacterized protein {ECO:0000313|EMBL:EFF11672.2} KW=Complete proteome OX=550677 OS=Escherichia coli B354. GN=ECEG_02419 OC=Enterobacteriaceae; Escherichia.
Sequence
MSTLLYLHGFNSSPRSAKASLLKNWLAEHHPDVEMIIPQLPPYPSDAAELLESIVLEHGG
DSLGIVGSSLGGYYATWLSQCFMLPAVVVNPAVRPFEVLTDYLGQNENPYTGQQYVLESR
HIYDLKVMQIDPLEAPDLIWLLQQTGDEVLDYRQAVAYYASCRQTVIEGGNHAFTGFEDY
FNPIVDFLGLHHL
Download sequence
Identical sequences D6JFH5
WP_000105737.1.39148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]