SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D6PYM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6PYM4
Domain Number 1 Region: 43-256
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 1.81e-110
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.0000000362
Further Details:      
 
Domain Number 2 Region: 1-42
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.33e-17
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D6PYM4
Sequence length 256
Comment (tr|D6PYM4|D6PYM4_9ARCH) Methyl-coenzyme M reductase alpha subunit {ECO:0000313|EMBL:ADG08074.1} OX=115547 OS=uncultured archaeon. GN=mcrA OC=Archaea; environmental samples.
Sequence
AMQIGMSFISAYHMCAGEAAVADLAFTAKHAGLIEMSEMLPARRARGPNEPGGLSFGHMC
DIVQTSRKFRDDPCKIALETCAAAMMLYDQIWLGGYMSGGVGFTMYATAAYTNNIVDDNL
YADTEYGWDTYGTSIGNVKAPTLDIIKDIGTWGALYGLELYENYPTALEDHFGGSQRATV
ISTATGAACAITTGNPNAGLSAWYLSMYLHKEAHGRLGFFGYDLQDQCGATNVFSYQSDE
GLLAEMRGANYPNYAM
Download sequence
Identical sequences D6PYM4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]