SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D6R9Y3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6R9Y3
Domain Number 1 Region: 8-57
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0000116
Family GABA-aminotransferase-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D6R9Y3
Sequence length 64
Comment (tr|D6R9Y3|D6R9Y3_HUMAN) Ethanolamine-phosphate phospho-lyase {ECO:0000313|Ensembl:ENSP00000422050} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ETNPPL OC=Catarrhini; Hominidae; Homo.
Sequence
MCELYSKRDTLGLRKKHIGPSCKVFFASDPIKIVRAQRQYMFDENGEQYLDCINNVAHDP
KPTT
Download sequence
Identical sequences D6R9Y3
ENSP00000422050 ENSP00000422050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]