SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D6RJ42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6RJ42
Domain Number 1 Region: 49-119
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000327
Family FAD-linked reductases, N-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D6RJ42
Sequence length 140
Comment (tr|D6RJ42|D6RJ42_MOUSE) FAD-dependent oxidoreductase domain-containing protein 1 {ECO:0000313|Ensembl:ENSMUSP00000120284} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Foxred1 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MFRRALRLGLGPGLPYRGLRTRKGGFTLDWDAKVSDFKKKVDSILPGKKYEVLYDTSHLP
PEQADVVIIGGGILGLSVAFWLKKLESRRGAIRVLVVEQDHTVSIHGLPPQGLLWAGFGS
SFPCLRMSSSHSFQSTFSGT
Download sequence
Identical sequences D6RJ42
ENSMUSP00000120284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]