SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D6W4X6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6W4X6
Domain Number 1 Region: 12-132
Classification Level Classification E-value
Superfamily TPR-like 7.59e-22
Family Tetratricopeptide repeat (TPR) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D6W4X6
Sequence length 267
Comment (tr|D6W4X6|D6W4X6_DROME) RT09031p {ECO:0000313|EMBL:ADI82805.2} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG13502 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MPRKKPKVDTLEEIETNIKLLCDQSNNHMKVRAYEKALFGYNQALELNSTDINALISRSK
CYLLLGEASKALQDAETALGEDKNNIRAIYQKAESLYYLGQFEQSLMFFHRGLRARPELA
LFRLGVQKTQEAIENTIGSKPGPPGPTASVPKSGKSRKSGEDTPKSQAAGATGTSARTRQ
KPSRADLERRNARKLLGELCVDKEYLEKLLLHPDLVRADTHTESISAYAREAVEFLNKRQ
EFWRQQRPCTALPNHKNLPHDALPKWF
Download sequence
Identical sequences A0A0J9RIK8 D6W4X6
FBpp0300561 NP_001246455.1.81976 XP_016029017.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]