SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D6WBK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6WBK5
Domain Number 1 Region: 341-619
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.16e-59
Family Eukaryotic proteases 0.0011
Further Details:      
 
Domain Number 2 Region: 72-110
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000877
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 221-285
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000361
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 4 Region: 121-160
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000864
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 34-70
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000589
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 158-199
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.002
Further Details:      
 
Weak hits

Sequence:  D6WBK5
Domain Number - Region: 300-359
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000542
Family Complement control module/SCR domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D6WBK5
Sequence length 635
Comment (tr|D6WBK5|D6WBK5_TRICA) Serine protease P46 {ECO:0000313|EMBL:EEZ99332.2} KW=Complete proteome; Reference proteome OX=7070 OS=Tribolium castaneum (Red flour beetle). GN=TcasGA2_TC004523 OC=Cucujiformia; Tenebrionidae; Tenebrionidae incertae sedis; Tribolium.
Sequence
MCNATLIQVICLFLAIQIVPSFSFHQSNITRREAKECPRNSFACKSGECIDEDKECDGGV
DCKDASDESNACARIKCPISAFRCDYGACISADLECDGKPDCRDGSDEKTPNCQIIDETS
PICKSNEFRCSSGECIDEDNKCDGIAQCSDRSDEIRATCWNLRCPIYSYKCKYGACVSGN
AECNGKIECQDGSDEDPNICKNSTVLTPTPSPVVPRPGARGRCVLPNHPEFGKWSIFGPE
NLSPGATVNPGTILNIVCQNGYKLEGNSVIYCANGQWTENIGVCLKLCSPLSSTKVMTVT
CTYPNNKGEGNCTNAIDGTLARFKCEPLYEDPNLQRIPGRVCRDGTWDNSSPECVPVCGQ
KSVEVQKLIVNGKTAKRGTYPWQAALYTRDKKELICGGSLIKLNMIITAAHCVTDQQERA
QPLPKENYIVALGKYYRKFDDPRDSKEAQFSELKKIIVNEKYSGPIQNFGSDIALLITST
VFVPSLRVQPVCMDWNLQFKIGDDQVFGYVTGWGYTVEGSNPSEELKELKVPLIPESKCR
KDLPVDYDRYYTYDKLCAGYLNSNTSVCRGDSGGGLVVKRNGDRFYLTGIVSLSPTSPRE
IDGCDSQQYGLYTKVAAHTEDFILKKVTEYGINAR
Download sequence
Identical sequences D6WBK5
7070.XP_967486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]