SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D6WHC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6WHC6
Domain Number 1 Region: 17-175
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.81e-43
Family Calponin-homology domain, CH-domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D6WHC6
Sequence length 188
Comment (tr|D6WHC6|D6WHC6_TRICA) Transgelin {ECO:0000256|RuleBase:RU361224} KW=Complete proteome; Reference proteome OX=7070 OS=Tribolium castaneum (Red flour beetle). GN=TcasGA2_TC002925 OC=Cucujiformia; Tenebrionidae; Tenebrionidae incertae sedis; Tribolium.
Sequence
MATNRATKSGFAAEAQRKVNAKYSEELAHESLEWIMNITGDNINTAGDMDNFYEVLKDGQ
LLCKLVNCIKPSIVKKVNNSQMAFKCMENINAFLEAAKELGVPAQETFQTVDLWERQNLN
SVVICLQSLGRKAGNYGKPSIGPKEAEKNERIFSEEKLKAGQTIIGLQMGSNKGANQSGI
NFGNTRHM
Download sequence
Identical sequences D6WHC6
7070.XP_975100 XP_975100.1.52716 TC002925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]