SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D6WNC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6WNC5
Domain Number 1 Region: 187-450
Classification Level Classification E-value
Superfamily RNI-like 2.98e-40
Family 28-residue LRR 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D6WNC5
Sequence length 499
Comment (tr|D6WNC5|D6WNC5_TRICA) T-complex-associated testis-expressed protein 1-like Protein {ECO:0000313|EMBL:EFA04350.1} KW=Complete proteome; Reference proteome OX=7070 OS=Tribolium castaneum (Red flour beetle). GN=TcasGA2_TC014646 OC=Cucujiformia; Tenebrionidae; Tenebrionidae incertae sedis; Tribolium.
Sequence
MRIPVTVNPNTLKTYNCYNERRIEKNTLRSDNLSSWDQAIPKTLQELCLESIAKNWQEKP
ILDEIIVTIDRCFLLNILPTDLPLALTVPKIHDDIYWKRCYLQRWPKVIPENVSLDVQIN
EIVKVSNSRKSSEESERSRKSSAEAGFKRTWKECFLEIHICEYLEKLKPEKYDAEKIKEL
ADLCTDYVKILDIRELQCSENSPNRIPLNAITSGLGNLTELSICFKQTYVGEKFTWDTVR
TSLQDIKLLAKGLEKCKLTVFRLRNSDIDDEKAVVILKSLLKHELETLDFSHCRIRDYGA
VAISKFCLENSVTNLILTNNRIGAKGIEAISYAICSPTCNLKSLDLKLNPISQRGVEILM
KPLTLSARKLKILHLNACGVGPISALGEMIEHNSHLEHLDLSNNPFGEEMGKIIMRGLRY
NTTLKKLDVRMCKLNSADEFEILQRINKNRIAMKRPRTARKPIIIEPQYKFEISDELLSE
MENVFQSNKSDETTNELIE
Download sequence
Identical sequences D6WNC5
XP_008194193.2.52716 XP_015836065.1.52716 TC014646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]