SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D6Y3T4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6Y3T4
Domain Number 1 Region: 4-264
Classification Level Classification E-value
Superfamily Cgl1923-like 6.02e-80
Family Cgl1923-like 0.00000473
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D6Y3T4
Sequence length 301
Comment (tr|D6Y3T4|D6Y3T4_THEBD) Uncharacterized protein {ECO:0000313|EMBL:ADG89036.1} KW=Complete proteome; Reference proteome OX=469371 OS=JCM 10125 / NBRC 14880 / R51). GN=Tbis_2326 OC=Thermobispora.
Sequence
MFDPTDLYRLDRDIPELTDPVLLYHFDGFVDAGGAGRLALGHLLATLEHRVIATFDVDRL
IDYRSRRPLMIFDTDRWVDYDTPELAIHLTQDLTGTPFLIMTGPEPDREWELFTEALGMI
VTQLKVAKLVTVHGIPMGVPHTRPLGYTAHQSRPGLVAAQPSPFGKVRVPAGLAALIEFR
LGAKGHDTFGFAIHVPHYLAQAEYPAAAVTALEAITRNTGLVFPMDGLREAAAKTTAEIE
EQISASVELSTAIRGLEQQFDAFHAGAARQDQQPENIHVPTGDELAAQFEAFLAEQEDRD
R
Download sequence
Identical sequences D6Y3T4
gi|296270297|ref|YP_003652929.1| WP_013132569.1.18579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]