SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7BQE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7BQE1
Domain Number 1 Region: 257-407
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000539
Family Protein kinases, catalytic subunit 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7BQE1
Sequence length 894
Comment (tr|D7BQE1|D7BQE1_STRBB) Putative integral membrane protein {ECO:0000313|EMBL:ADI07170.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_04049 OC=Streptomyces.
Sequence
MSGDEPLLPARVHRPFDLLRLLLGILGIGTVLAIAAFAHGTTAGLEKDIGHGADQAPTLL
IDFAGLAASVAVLLLPMAFAIERLIKRDGLRIADGVLAAVLAHGVSLATDLWVARGAPGS
IREALTQTAPGGTLSDPVHGYLAPVIAYMTAVGMARRPRWRVAMWFVLLLDAFAVLVGGY
TTPFSIIITVLIGWTVAYGTLYAVGSPNVRPTGQHLLAGLRRVGFAPVSALRYDDSDSAD
DSHGDQTARTGQAGHTGDRGRRYLVTLEDGPPLDVTVVDREQQAQGFFYRVWQRLTLRTI
TPPRSLQSLRQALEQEALLSYAAIAAGANAPKLIATSELGPDAVMLVYEHLGGRPLNALP
DEAITDELLAEAWQQVQALQSRRIAHRRLDGDALLVDRSGKVVLTDLRGGEIAAGDVVLR
MDVAQLLTTLGLRVGAERSVAAAARVLGPDAVADSLPLLQPLALNRSTRATLRQLARERA
QRQREAVLEASRAAKEAREAKAAKEAAEAGEAAQQSEAADETAEKARHRPTAAAAAVDRK
VLKAEKQAEKRAIDEALEGAREEDLLSQIRQQVLLIRPQAPIEPVRLERIKPRTLVSFCA
GAFAAYFLLSQFTHIKLGTVVGEANWIWVVAALLFSALTYVAAALSLLGFVPEKVPFGRT
VLAQVAASFVKLVAPAAVGGVALNARFLQRQGVRPGLAVASVGASQLFGLASHILLLLTF
GYITGTERTPTLSPSRTVIAGLLTAAVLALVVAAIPVLRKFVSTRVRSLFAGVVPRMLDV
LQRPKKLLTGIGGMLLLTAANVLCLDSSIRAFGGDMSYASIAVVFLAGNALGSAAPTPGG
VGAVEAALIAGLTLAGLPYETAAPAVLLFRLMVFWLPVLPGWLAFTHLTRKEAL
Download sequence
Identical sequences D7BQE1
gi|374986806|ref|YP_004962301.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]