SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7BRM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7BRM3
Domain Number 1 Region: 18-266
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-54
Family Protein kinases, catalytic subunit 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7BRM3
Sequence length 633
Comment (tr|D7BRM3|D7BRM3_STRBB) Serine/threonine protein kinase-like protein {ECO:0000313|EMBL:ADI05186.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_02065 OC=Streptomyces.
Sequence
MRPGGKVGKYRLTKGPVNGGRGAVWFAVDTELDRPVVLKRTLAENNSRAAFDELLAEARA
LAKFSHPNVVTLYGAERAGWGPKATFWLVMEHVTGGSLNGTARLPAKLAAHIGAQIANAL
AALHTKGIVHCDVKPHNVVITEDGVAKLADFGAAYRIDGSTTNTPSGSFSLTPAYAAPEA
FQGAPERASDLFSLGATVYALVTGEAPPRGPRRTIRTEALGDLVEDGPLREVLTALLQRD
PGRRPGAEEAQRALAEVAGPVDQLPRVPLEEVTKPYPPPEGPGEHSEHAAAGAARLPSLL
RRRPLLTGGTAATVVAIAAVATVLGLHDGDGGGPPAHADESPTATPTATAGGGFGLGDPR
TVDPCALLSTGSFERFGHHAQLDPQYGNYDRCDVVLSSDDDDIVDVTVDLDTEDPPSAAV
TRTSGKVGVVTEPAESGWCGRTLVLSGVRDTVIRVAVKLTEDVKAPLCDIADAAVEHAVT
VLNRGEVPRRSPKLPADSLAQQDACGLLNGRELEVVPGIDARDPDVGFGRWTCDWASTTN
RMTVRLAFDQGILSIPDNARFTELAGHDAVVMPEYEGDGSCTIDVFDRPYRSRDDRPTER
LRLEVGGARAKDRPSCETATDLARSATAALSAG
Download sequence
Identical sequences D7BRM3
gi|374984822|ref|YP_004960317.1| WP_014174665.1.69245 WP_014174665.1.9551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]