SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7BUT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7BUT3
Domain Number 1 Region: 22-270
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.35e-44
Family APH phosphotransferases 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7BUT3
Sequence length 299
Comment (tr|D7BUT3|D7BUT3_STRBB) Aminoglycoside phosphotransferase {ECO:0000313|EMBL:ADI03274.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_00153 OC=Streptomyces.
Sequence
MAIGRTADPRPAIDAALARCLVDTQFPQWAELPLELLDPAGSDHVIYRLGKDLSVRLPRH
AGAIRQAVKEFEWLPRLAPHLPLAIPVPVGVGEPDFDYPWPWAVSRWLDGEVATAEALAD
SSRAAVQLAEFLTALQEIVPEEFPVEDAREDLTGRPLADRDRATRAAIGEVDGTFDTAAM
TALWDAALSAPGWDRPPVWFHGDFHTGNLLTVDGRLSAVIDFGGLGIGDPACDLTIAFTL
MSAGSRAAFRAALGVDDATWTLGRGWALATGLNAYTSYAAVNPRVAAQTTRQITAALIG
Download sequence
Identical sequences D7BUT3
gi|374982910|ref|YP_004958405.1| WP_014172753.1.69245 WP_014172753.1.9551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]