SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7BVG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7BVG6
Domain Number 1 Region: 12-278
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-61
Family Protein kinases, catalytic subunit 0.0000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7BVG6
Sequence length 516
Comment (tr|D7BVG6|D7BVG6_STRBB) Serine/threonine protein kinase {ECO:0000313|EMBL:ADI07567.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_04447 OC=Streptomyces.
Sequence
MMPLEDDDPREVGGYRLLFRLGAGGMGRVYLGRSADGRYVALKTVHPWLASAPGFRERFA
REIRASQSVSGRGTVKVVAADAEAATPWLASAYVPGPSLDEIVHEHGPLPEPSVWRLLSG
LAGALESVHGRGLIHRDVKPSNVLVSQDGPLLIDFGIARAADETGLTGTGLAVGSAGYMS
PEQAEGRELTAAADVFALGAVLVYAVTGRGPFGTGSGLELLYRVVHREPDLGGVPGAPAA
VARDCLGKRPEDRPTVAELYALAAERDTGERDWLPGPVSAVIARRAEHLLNLESAEAPHA
PQPDPAVGEGLPPTKVDPHPGSAPTRQGDADPQSRVVRLREWVRGGGLGSPALSMWGLVP
MLVLPLMAPKLRTIVRDYPETPDNIDFGGLSEWAQHNDWFMPVPALLVLALLGLQYTGAR
LQRYSERGIRIWAAAGAVYWLLWSGSVALSAAWMLGMDDGLSGDAATPHTNGAYIALHVC
LMLALGGNAIAAPFVGIGAVARLNRALTHEVTATYP
Download sequence
Identical sequences D7BVG6
gi|374987203|ref|YP_004962698.1| WP_014177038.1.69245 WP_014177038.1.9551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]