SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7BVH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7BVH5
Domain Number 1 Region: 203-401
Classification Level Classification E-value
Superfamily SIS domain 6.97e-26
Family double-SIS domain 0.018
Further Details:      
 
Domain Number 2 Region: 91-163
Classification Level Classification E-value
Superfamily SIS domain 0.00000000005
Family mono-SIS domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7BVH5
Sequence length 406
Comment (tr|D7BVH5|D7BVH5_STRBB) Uncharacterized protein {ECO:0000313|EMBL:ADI07576.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_04456 OC=Streptomyces.
Sequence
MLDESLLDAPEALARADVRGLLRGAAESGARVRTAARYAAEAGVADLKPDGRPRSVLVAG
PGAAGSCTADLLGALSGTNCPVSLIAPTGVAPAPGALRWTLPGWAGPLDLLLLVTPDGAE
PGLPPLVEQAYRRGCSIVAVAPADSPLAGAVEQARGLMVPLAAGPDNNSAPYDTAPPAPA
GTPQAEGQHTEPTGTAQDEVTGPALPGTLWALLTPLLVLVDRIGLVAAPPSALMQVADRL
DQVAERCGPAVATYTNPAKALAAELAGSLPLLWTEGPVAAAAGRRFASLLALLAGRPALV
AELPGALAAHGTLLAGSLAGGADPDDFFRDRVEEAEALRARVVLLYDEQVSALSAVPTAR
ELALAHDTALSELEPGGGGVLENAAELLAITDFTAVYLALASTERS
Download sequence
Identical sequences D7BVH5
gi|374987212|ref|YP_004962707.1| WP_014177047.1.69245 WP_014177047.1.9551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]