SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7BW65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7BW65
Domain Number 1 Region: 16-319
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.69e-49
Family APH phosphotransferases 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7BW65
Sequence length 348
Comment (tr|D7BW65|D7BW65_STRBB) Putative acyl-CoA dehydrogenase {ECO:0000313|EMBL:ADI11775.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_08657 OC=Streptomyces.
Sequence
MTCSTPLADTTNPPGLELGALSRWFGANVPACQGPLAAAVLHGGRSNLTYLVTDGHSRWV
VRRPPLGGLTPSAHDIGREFRVMSALRATGVAVPGTVAHCTDQDVTGAPFTVVAYVEGRV
LRSRADTAGLTPYDLGRCADGLVEQLARLHALSYTEAGLSGWGRPEGYLRRQLDRWRTQW
DLVATRQLSELPRLHKALEDALPRESDASIVHGDFRVDNTILDPTDLSRVRAVVDWELST
LGDPLADLGTFLAYRDPAVDALLDSPAATDPGFPGPFELAELYALLSGRDITLLPFYQAL
AYFKIAVIAEGVYARHLQGVTVGEGFAGAGASVPELVKAGLALLGRRR
Download sequence
Identical sequences D7BW65
gi|374991411|ref|YP_004966906.1| WP_014181224.1.69245 WP_014181224.1.9551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]