SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7BWW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7BWW6
Domain Number 1 Region: 5-39
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000267
Family Protein kinases, catalytic subunit 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7BWW6
Sequence length 59
Comment (tr|D7BWW6|D7BWW6_STRBB) Uncharacterized protein {ECO:0000313|EMBL:ADI05511.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_02390 OC=Streptomyces.
Sequence
MTDRDLLGGRYRLLRKIGLGGMGVVYEALDSTLDRRVAVAADWPICSRSPVTTSRRAKC
Download sequence
Identical sequences D7BWW6
WP_014174989.1.69245 gi|374985147|ref|YP_004960642.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]