SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7BX04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7BX04
Domain Number 1 Region: 13-270
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.93e-21
Family APH phosphotransferases 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7BX04
Sequence length 322
Comment (tr|D7BX04|D7BX04_STRBB) Uncharacterized protein {ECO:0000313|EMBL:ADI05549.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_02428 OC=Streptomyces.
Sequence
MSGTVREDVVPQLADVVRSRSAPHHGPVGEPIVLADRRDATVIRHGSVVAKAHAPDTDPD
ELSVRVQVAGHPRCAGILLPPLGGPEALPGGRAVTLWPYGEPVSPDHPEAAPWAEAGALL
ARLHSVEPAALPGPLPPMRGPAKAARAVARLRRAGAGAEGAGAEAVVEAVLRAWGALPGW
ARGEGAAPQGGALCHGDLHLGQLVRSAEPSNPPARWLLIDVDDLGLGDPAWDLARPAAWF
AAGLLAPDDWGRFLGAYRAAGGPAVRECQEDPWARLDVPARALTVQISALALAKAAREGR
PLDEAEESMVEACLRIARLAGA
Download sequence
Identical sequences D7BX04
WP_014175026.1.69245 gi|374985185|ref|YP_004960680.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]