SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7BY77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7BY77
Domain Number 1 Region: 49-253
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.24e-25
Family RIO1-like kinases 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7BY77
Sequence length 323
Comment (tr|D7BY77|D7BY77_STRBB) Aminoglycoside phosphotransferase {ECO:0000313|EMBL:ADI11957.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_08839 OC=Streptomyces.
Sequence
MAHDPDADLAPAAPGLPSATGSRRMAWAAMPRGLTARIERLLGSPVATAVSQPGGFSEGL
AARVRLADGRRAFIKAASSSTAPAVADFHRREIAVSRRLPPEAPAPRLLEAYDDGTWVVL
VFEEIPGHLPAQPWRPDELDRVIAAVTDMATALTPSPVEAAILSKPRLGGWPALAEDTAA
RAKVEKLSPWAARHFDELAALEANASLDGDTLLHGDLYPFNIMLTADRVFVVDWPHAWIG
PRHCDLVTLLSSASLSGVDPQPIAESHPLIRALDRVHVDSVLAAHAGFLLRSAASAGPGT
DRNIVAMMTALGLASLRWLGRRL
Download sequence
Identical sequences D7BY77
gi|374991593|ref|YP_004967088.1| WP_014181404.1.69245 WP_014181404.1.9551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]