SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7BYH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7BYH6
Domain Number 1 Region: 9-322
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.19e-32
Family Quinoprotein alcohol dehydrogenase-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7BYH6
Sequence length 323
Comment (tr|D7BYH6|D7BYH6_STRBB) WD-40 repeat protein {ECO:0000313|EMBL:ADI03504.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_00383 OC=Streptomyces.
Sequence
MSDERLILSSVAPGGPVHGLAVVDVDGEPLVVCTGFYKLWTWAPLRDEWLERPLASAFAA
EYPDAENDIDSVAVAVFDGRVVLAAGGDEQGASIWDLFSGELLRGNTHNGPYIASIATVK
NAGPPLFVASSGIHWDGVELWGLGEEPPIELDAGSVWGLATARIDGRSLVAGGNEEGVTV
WDVANGEEVASFYVDDEQRSYAVGFSEVDGRPVVVAGTDSGKVYVFDLAAGEDDDPIHEP
ATGHEGGINALDIAVVGDRPVAVTGGEDGTVRIWDLAGGRPVGPPLTGHDARVEAVAVTT
LRDRPVALTAGRDGAVRVWDLAL
Download sequence
Identical sequences D7BYH6
gi|374983140|ref|YP_004958635.1| WP_014172983.1.69245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]