SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7BZG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7BZG3
Domain Number 1 Region: 36-291
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.01e-62
Family Protein kinases, catalytic subunit 0.0000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7BZG3
Sequence length 520
Comment (tr|D7BZG3|D7BZG3_STRBB) Serine-threonine protein kinase {ECO:0000313|EMBL:ADI07899.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_04779 OC=Streptomyces.
Sequence
MGGSEMPVPDGPSAEGPLPGPSRAPDGVAPPAAGDPAHIGSFRLVGRLGAGGMGRVYLGV
SRAGRPTAVKVVRADLAEEPAFRRRFAAEVAAARRVQGPYTPAVVAADPDAELPWLATSY
IAGPSLGETVDDGGPLAPPMARRLGAGVAEALGAIHAAGMVHRDLKPSNVLLAADGPKVI
DFGIAAAADATRLTSTGVRLGTIGFMSPEQADGRPITPASDIFALGCLLAYAVTGRPPFG
DGPPSEVLYRVINAEPDPDHLDCGDPELSVLIGRCLRKWPADRPTVDEVIDACATREGQP
PGWPDARLGPRIAGAHAALERALSRGPSGDSGGSGSGRPVAEDRTAKGRGAWRSRRGAMA
GALLGVAAVAVVIAVVLTTSGDEDGGGARYTAGYKGRTLTLPDYDHYIDLPTGKVVKGDG
RWMLSTNSGGDGHGAFELQDATEAQVAGERSVTPERCAELVAHRPLLEKVRFAQAPAGRW
FCMRDRISGDVAVVQVLDTDSGDYTVTVAVDYYRRGAATG
Download sequence
Identical sequences D7BZG3
gi|374987535|ref|YP_004963030.1| WP_014177369.1.69245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]