SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7BZR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7BZR2
Domain Number 1 Region: 1-387
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 3.49e-65
Family Gtf glycosyltransferase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7BZR2
Sequence length 401
Comment (tr|D7BZR2|D7BZR2_STRBB) Glycosyl transferase, NDP-D-desosamine: 3-L-mycarosyl erythronolide B {ECO:0000313|EMBL:ADI09967.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_06847 OC=Streptomyces.
Sequence
MRVLMVVTPVSSHLQPLVPLAWALTGAGHEVMCAGEPGAVEAARAAGLHTLAIEAEPLPA
DAPPPAPARRPTGGEPAAVWEPDWEALAVRWRARVGRVLDGYLRFAREWRPHLVLSDPVE
FCGPIVAGALGVPSVVHRWGTDVLTTLARGPARAALRSVCERAGIPGGLLPDPDLLLDPC
PPLLRHPRAAPARPVRFVPYNGPGSYPSWGPLRSPEQRTICVSFSAQTIERSGMATLAAT
AGAFEGLEGVRGVFTLPRARAEELGALPANVRVIEPTPLSQLLRRCTALIHHGGSGTGLT
ALHYGLPQLVLAPPLPSLGVYAERIAACGAGRSLDPGEQQDPEAIRTVLRELLDDRSYGA
AAGRVREEMAAMPAPAEVVAELEELAGPRIGVSRVAGSRAA
Download sequence
Identical sequences D7BZR2
WP_014179417.1.69245 WP_014179417.1.9551 gi|374989603|ref|YP_004965098.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]