SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7C123 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7C123
Domain Number 1 Region: 12-297
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-67
Family Protein kinases, catalytic subunit 0.0000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7C123
Sequence length 578
Comment (tr|D7C123|D7C123_STRBB) Serine/threonine protein kinase {ECO:0000313|EMBL:ADI07924.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_04804 OC=Streptomyces.
Sequence
MWGMGSFGGSDRLLAGRYQLVGRLGRGGMGTVWRAVDTLLGRDVAVKELHFDEELDGMSA
LDVQQQHERTLREARTVAQIKHPNVIVLHDVVEEDGRPWIVMELVDGSSLADQLAAEGAV
GPREAARVGVALVDALRVAHARGVLHRDIKPANVLVEAGTRRVVLTDFGIAQVTGSTTIT
ETGTFVGSPEYTAPERMSGRRTGPESDLWSLGVLLCTLVSGESPFRRDSLGGVLHAVVFD
EIRAPEAAGALAPVIEGLLQRDPDVRLTGDAAARMLRMCLAPGDTPEIPLEYTPTQPAVP
VSTGRAPGHAPGHAPGYDGAEGYGAAGYGASGAAAGATPAAAPAAPEAPTPVAPAPRGRG
PRGRTALMAAVAVVALAGLGAGVAVLALDRGDDDGANEGRGGDKATATATTDPGKKPSKA
PPTPSKAAVPDGYELVDDPAGFTIAVPKGYSRDFKPPRVYYNSPGMEFRIGIHIQEPDPK
GPLQLSQEADARGPQDYPGYRGGQVIETDRKGQPAALWAFIWNGSADDGGSRQTYDLTWN
DAGKMYDVWVSAPVGEKSEGKQHFDTAVNTFSRSADQN
Download sequence
Identical sequences D7C123
gi|374987560|ref|YP_004963055.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]