SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7C624 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7C624
Domain Number 1 Region: 25-278
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.66e-60
Family Protein kinases, catalytic subunit 0.0000841
Further Details:      
 
Domain Number 2 Region: 664-769
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000000816
Family Quinoprotein alcohol dehydrogenase-like 0.0028
Further Details:      
 
Domain Number 3 Region: 415-465,522-652,685-745
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000361
Family Quinoprotein alcohol dehydrogenase-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7C624
Sequence length 778
Comment (tr|D7C624|D7C624_STRBB) Serine/threonine protein kinase-like protein {ECO:0000313|EMBL:ADI04012.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_00891 OC=Streptomyces.
Sequence
MTVNVTADEPALPVRPLLGHDPESFGRYRLLARLGSGGMGTVFLARSDGGRTVALKAIHR
DLAEEREFRERFRQELQAARSLGGADFFPAVVDADTDGPRPWLASEYLLGPSLAQAVEAH
GPWPYAALRALGVALARGLATVHRQGLVHRDLKPSNVLITADGPKLIDFGLARAVGAERL
TRTGRQMGTPAYISPEQARPVGGQSAGPPADVFALGGLLVYAATGRAPFGEGGANDVLYR
VAYAEPDLAGVPEELWPLVVGCLAKDPADRPAADRIARALTGTGTGDDGERDRDLDLDRQ
WDGERQRDGERERFAGLLPAGVLHDIALRTATVWDVAVRRPEEPQAPASAATAPEAPPPQ
DAPRPARRRLVLGGLGALAAAGVAGGVWWAVAGSGDDDTRGEPRPGPGGSGTDTAPQPLW
EYRGPLGDLGTPLYHRGVIAVQADPGAGILGVDARRGTLRWTAPAVSGYTPMACGDLIVM
KATYADGDDRLAMVDPADGRTWYSDPLGVTFRFTDHPISAGDARTAYVTGHSGAHRDGTP
DSRRRYLLAYDMVARKVRWRRELERGSATHLPGVVAEGRLVLVDDGSVTAYDTADGRRRW
QVALPGDGLVAGDGSDMVPRWTATVARGTVLMTGSGLRTIDLRTGRGGRQLDPDQLPSGT
GDEAVFGVPALADGVAYLTVLGTHVFAIDLASHHVRWRWKADTDLASPPAGTAVAGGLVF
PPSSDSRAAAVAVDRRTGRTRWTLRDSSGSILGTTEPLVGQGRLYVVRGKSIRALPLT
Download sequence
Identical sequences D7C624
gi|374983648|ref|YP_004959143.1| WP_014173491.1.69245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]