SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7C908 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7C908
Domain Number 1 Region: 16-288,315-363
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.74e-74
Family Protein kinases, catalytic subunit 0.000000395
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7C908
Sequence length 561
Comment (tr|D7C908|D7C908_STRBB) Serine/threonine protein kinase {ECO:0000313|EMBL:ADI08559.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_05439 OC=Streptomyces.
Sequence
MSQQGAPGRYEGKSLAGGRYQLRDLLGEGGMASVHLAYDSVLDRQVAIKTLHTELGREQS
FRERFRREAQSVAKLSHTNIVSVFDTGEDTIDGSVMPYIVMEYVEGQPLRAVLDADARQF
GAMPTEKALKITADVLAALEISHEMGLVHRDIKPGNVMMTKRNVVKVMDFGIARAMQSGV
TSMTQTGMVVGTPQYLSPEQALGRGVDARSDLYSVGIMLFELLTGRLPFDADSPLAIAYA
HVQEEPVAPSTINQSIPPAVDALVARALKKNPNERFPTAEAMRDECDRVSRTGQTGASPI
IISGGPPARSGSGVGSAVFPPVSQQPPGPGMGSVQTPYQPQSSGGFGGFGPSTPPPSAQP
MPQQGYNTPAPAPTPAPTPAPYAQGGANTPPPYTVSPASAPASGGGQGGDNGNKRVIIGS
AVVAAIAVIAVVLVIALSGGGSDDGGQARDDGKDTKTATASSTPSGFREGDKTKVINPEK
CKDASESYEQKGAYNVPDFQNLYIDSVKKCIRDAGWKYRVTTEDENLWGKGTVLNYTYRN
YEPYDPDTDTIELTVSTGLPG
Download sequence
Identical sequences D7C908
gi|374988195|ref|YP_004963690.1| WP_014178023.1.69245 WP_014178023.1.9551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]