SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7CA47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7CA47
Domain Number 1 Region: 60-150
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000133
Family APH phosphotransferases 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7CA47
Sequence length 157
Comment (tr|D7CA47|D7CA47_STRBB) Phosphotransferase {ECO:0000313|EMBL:ADI04375.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_01254 OC=Streptomyces.
Sequence
MSMFSTLVGADRLRDHDDLQLDEPAEHHLCHGLPVLASDVAQDRVREEVVPAFGERPPRL
DRHTALRALHEQLPVADCPFSWSVDHRLGIARRAGIEVPADLPEAPPVDHLVVCHGDPCA
PNTLLPEEGSWSAHVDLGALGVADRWADLAAPPGVPT
Download sequence
Identical sequences D7CA47
gi|374984011|ref|YP_004959506.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]